Interstitial collagenase

UniProt : P03956, UniProt ID: MMP1_HUMAN,

Interstitial collagenase

Homo sapiens

MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Interstitial collagenase contains a PF00045 domain.

Interstitial collagenase contains a PF01471 domain.

Interstitial collagenase contains a PF00413 domain.

Interstitial collagenase contains a PF00045 domain.

Interstitial collagenase contains a PF00045 domain.

Interstitial collagenase contains a PF00045 domain.

Interstitial collagenase is proteolytically cut by chymase (S01.140) cleavage. QFVL-TEGN.

Interstitial collagenase is proteolytically cut by plasmin (S01.233) cleavage. DVAQ-FVLT.

Interstitial collagenase is proteolytically cut by trypsin 1 (S01.151) cleavage. DVAQ-FVLT.

Interstitial collagenase is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DVAQ-FVLT.

Interstitial collagenase is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. PVQP-IGPQ.

Interstitial collagenase is proteolytically cut by pseudolysin (M04.005) cleavage. AQFV-LTEG.

Interstitial collagenase is proteolytically cut by vibriolysin (M04.003) cleavage. AQFV-LTEG.

Interstitial collagenase is proteolytically cut by thermolysin (M04.001) cleavage. AQFV-LTEG.

Interstitial collagenase is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DVAQ-FVLT.

Interstitial collagenase is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. TLKV-MKQP.

Interstitial collagenase is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. VAQF-VLTE.

Interstitial collagenase is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. AQFV-LTEG.

Interstitial collagenase is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. DAET-LKVM.

Interstitial collagenase is proteolytically cut by plasma kallikrein (S01.212) cleavage. VEKR-RNSG.

Interstitial collagenase is proteolytically cut by plasma kallikrein (S01.212) cleavage. EKRR-NSGP.

Interstitial collagenase is proteolytically cut by chymotrypsin B (S01.152) cleavage. EKRR-NSGP.

Interstitial collagenase is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. DVAQ-FVLT.

Interstitial collagenase is proteolytically cut by plasma kallikrein (S01.212) cleavage. VEKR-RNSG.

Interstitial collagenase is proteolytically cut by plasma kallikrein (S01.212) cleavage. EKRR-NSGP.

Interstitial collagenase is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DVAQ-FVLT.

Interstitial collagenase is proteolytically cut by u-plasminogen activator (S01.231) cleavage..

Interstitial collagenase is proteolytically cut by trypsin () cleavage. VAQF-VLTE.