CD74 molecule, major histocompatibility complex, class II invariant chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_a)
UniProt : Q8SNA0, UniProt ID: Q8SNA0_HUMAN, CD74 molecule, major histocompatibility complex, class II invariant chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_a) Homo sapiens MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM GALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
CD74 molecule, major histocompatibility complex, class II invariant chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_a) contains a PF08831 domain.
CD74 molecule, major histocompatibility complex, class II invariant chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_a) contains a PF09307 domain.
CD74 molecule, major histocompatibility complex, class II invariant chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_a) is proteolytically cut by () cleavage..