CD74 molecule, major histocompatibility complex, class II invariant chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_a)

UniProt : Q8SNA0, UniProt ID: Q8SNA0_HUMAN,

CD74 molecule, major histocompatibility complex, class II invariant chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_a)

Homo sapiens

MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM
GALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CD74 molecule, major histocompatibility complex, class II invariant chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_a) contains a PF08831 domain.

CD74 molecule, major histocompatibility complex, class II invariant chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_a) contains a PF09307 domain.

CD74 molecule, major histocompatibility complex, class II invariant chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_a) is proteolytically cut by () cleavage..