cDNA FLJ56699, highly similar to HLA class II histocompatibility antigen gamma chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_c)

UniProt : B4DNE8, P04233, UniProt ID: B4DNE8_HUMAN, HG2A_HUMAN,

cDNA FLJ56699, highly similar to HLA class II histocompatibility antigen gamma chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_c)

Homo sapiens

MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLL
LAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPM
GALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKV
FESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLP
LQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ56699, highly similar to HLA class II histocompatibility antigen gamma chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_c) contains a PF00086 domain.

cDNA FLJ56699, highly similar to HLA class II histocompatibility antigen gamma chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_c) contains a PF08831 domain.

cDNA FLJ56699, highly similar to HLA class II histocompatibility antigen gamma chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_c) contains a PF09307 domain.

cDNA FLJ56699, highly similar to HLA class II histocompatibility antigen gamma chain (CD74 antigen (Invariant polypeptide of major histocompatibility complex, class II antigen-associated), isoform CRA_c) is proteolytically cut by I-CLiP () cleavage..