Transglutaminase

UniProt : Q6E0Y3, UniProt ID: Q6E0Y3_STRMB,

Transglutaminase

Streptomyces mobaraensis

MHRRIHAVGQARPPPTMARGKETKSYAETYRLTADDVANINALNESAPAASSAGPSFRAP
DSDDRVTPPAEPLDRMPDPYRPSYGRAETVVNNYIRKWQQVYSHRDGRKQQMTEEQREWL
SYGCVGVTWVNSGQYPTNRLAFASFDEDRFKNELKNGRPRSGETRAEFEGRVAKESFDEE
KGFQRAREVASVMNRALENAHDESAYLDNLKKELANGNDALRNEDARSPFYSALRNTPSF
KERNGGNHDPSRMKAVIYSKHFWSGQDRSSSADKRKYGDPDAFRSAPGTGLVDMSRDRNI
PRSPTSPGEGFVNFDYGWFGAQTEADADKTVWTHGNHYHAPNGSLGCHACLTRASSATGS
EGYSDFDRGEPYVVSPSPSPRMLEHRPRQGKAGLA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Transglutaminase contains a PF09017 domain.

Transglutaminase is proteolytically cut by PS-10 peptidase (S37.001) cleavage. FRAP-DSDD.

Transglutaminase is proteolytically cut by SAM-P45 peptidase (S08.069) cleavage. AGPS-FRAP.

Transglutaminase is proteolytically cut by chymotrypsin A (S01.001) cleavage. GPSF-RAPD.

Transglutaminase is proteolytically cut by griselysin (M04.017) cleavage. AGPS-FRAP.