Sodium channel, voltage-gated, type II, beta (cDNA, FLJ94526, Homo sapiens sodium channel, voltage-gated, type II, beta (SCN2B),mRNA)

UniProt : O60939, Q5U0K8, UniProt ID: Q5U0K8_HUMAN, SCN2B_HUMAN,

Sodium channel, voltage-gated, type II, beta (cDNA, FLJ94526, Homo sapiens sodium channel, voltage-gated, type II, beta (SCN2B),mRNA)

Homo sapiens

MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNH
KQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE
DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVV
KCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sodium channel, voltage-gated, type II, beta (cDNA, FLJ94526, Homo sapiens sodium channel, voltage-gated, type II, beta (SCN2B),mRNA) contains a PF07686 domain.

Sodium channel, voltage-gated, type II, beta (cDNA, FLJ94526, Homo sapiens sodium channel, voltage-gated, type II, beta (SCN2B),mRNA) is proteolytically cut by memapsin-2 (A01.004) cleavage. KIHL-QVLM.