Collagenase 3

UniProt : P45452, UniProt ID: MMP13_HUMAN,

Collagenase 3

Homo sapiens

MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA
ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY
RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM
FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY
DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagenase 3 contains a PF00413 domain.

Collagenase 3 contains a PF01471 domain.

Collagenase 3 contains a PF00045 domain.

Collagenase 3 contains a PF00045 domain.

Collagenase 3 contains a PF00045 domain.

Collagenase 3 contains a PF00045 domain.

Collagenase 3 is proteolytically cut by plasmin (S01.233) cleavage. GILK-ENAA.

Collagenase 3 is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DVGE-YNVF.

Collagenase 3 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. NLAG-ILKE.

Collagenase 3 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. SFFG-LEVT.

Collagenase 3 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. DVGE-YNVF.

Collagenase 3 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. DVGE-YNVF.

Collagenase 3 is proteolytically cut by plasmin (S01.233) cleavage. KKPR-CGVP.

Collagenase 3 is proteolytically cut by plasmin (S01.233) cleavage. DVGE-YNVF.

Collagenase 3 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. NLAG-ILKE.

Collagenase 3 is proteolytically cut by plasmin (S01.233) cleavage. GILK-ENAA.

Collagenase 3 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DVGE-YNVF.

Collagenase 3 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. SFFG-LEVT.

Collagenase 3 is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. GPSG-LLAH.

Collagenase 3 is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. GIQS-LYGP.