Dibasic-processing endoprotease

UniProt : Q09175, UniProt ID: KRP1_SCHPO,

Dibasic-processing endoprotease

Schizosaccharomyces pombe

MHPALLCGPILAIFLQFLVSSCSPLENDDLFLVQVEPEVDPVVAAEAIGAKYVRPLLNLK
YHHLIKLHKGSDDSVQSSIRKRGIDAGILELERQTPRWRYKRDASESDELLNEFSNHFGI
SDPLFYGQWHIFNSNNPGHDLNLREVWDAGYFGENVTVAFVDDGIDFKHPDLQAAYTSLG
SWDFNDNIADPLPKLSDDQHGTRCAGEVAAAWNDVCGVGIAPRAKVAGLRILSAPITDAV
ESEALNYGFQTNHIYSCSWGPADDGRAMDAPNTATRRALMNGVLNGRNGLGSIFVFASGN
GGHYHDNCNFDGYTNSIFSATIGAVDAEHKIPFYSEVCAAQLVSAYSSGSHLSILTTNPE
GTCTRSHGGTSAAAPLASAVYALALSIRPDLSWRDIQHITVYSASPFDSPSQNAEWQKTP
AGFQFSHHFGFGKLDASKFVEVAKDWQVVNPQTWLIAPEINVNKSFGSVNNETITEMVSE
FTVTKDMIEKSNFKRLEHVTVRVCIPFNRRGALEILLESPSGIRSILASERPYDENSKGF
LDWTFMTVQHWAEPPEGVWKLLVNDRSGGKHEGTFENWQLALWGESENPSNTAPLPYDTL
ELPKEMVLGIYSEPNSDLTNSSTLLSPTSTSFTSYTVSATATPTSTSHIPIPTVLPPTQP
VLEPSYREIVAFITFFLLFAFIFVAVIWTWISAFWKAKAPPPLSQQEIA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Dibasic-processing endoprotease contains a PF00082 domain.

Dibasic-processing endoprotease contains a PF01483 domain.

Dibasic-processing endoprotease is proteolytically cut by KEX2 g.p. (S08.070) cleavage. RYKR-DASE.