C-type natriuretic peptide

UniProt : P18104, UniProt ID: ANFC_PIG,

C-type natriuretic peptide

Sus scrofa

MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEEVAEPQAAGGGQKKGDKTPGGG
GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS
MSGLGC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

C-type natriuretic peptide contains a PF00212 domain.

C-type natriuretic peptide is proteolytically cut by insulysin (M16.002) cleavage. GCFG-LKLD.

C-type natriuretic peptide is proteolytically cut by insulysin (M16.002) cleavage. LKLD-RIGS.