C-type natriuretic peptide

UniProt : P23582, UniProt ID: ANFC_HUMAN,

C-type natriuretic peptide

Homo sapiens

MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGG
GANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGS
MSGLGC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

C-type natriuretic peptide contains a PF00212 domain.

C-type natriuretic peptide is proteolytically cut by neprilysin (M13.001) cleavage. RIGS-MSGL.

C-type natriuretic peptide is proteolytically cut by neprilysin (M13.001) cleavage. SMSG-LGC.

C-type natriuretic peptide is proteolytically cut by neprilysin (M13.001) cleavage. FGLK-LDRI.

C-type natriuretic peptide is proteolytically cut by neprilysin (M13.001) cleavage. KLDR-IGSM.

C-type natriuretic peptide is proteolytically cut by neprilysin (M13.001) cleavage. GCFG-LKLD.

C-type natriuretic peptide is proteolytically cut by neprilysin (M13.001) cleavage. SKGC-FGLK.