Collagen alpha-1(X) chain

UniProt : P08125, UniProt ID: COAA1_CHICK,

Collagen alpha-1(X) chain

Gallus gallus

MHLQISLLLLFCLNIVHGSDGYFSERYQKQSSIKGPPHFLPFNVKSQGVQMRGEQGPPGP
PGPIGPRGQPGPAGKPGFGSPGPQGPPGPLGPPGFSTVGKLGMPGLPGKPGERGLNGEKG
EAGPVGLPGARGPQGPPGIPGPAGLSVLGKPGPQGPPGAQGPRGPPGEKGEPGVPGINGQ
KGEMGFGVPGRPGNRGLPGPQGPQGLPGSAGIGKPGENGLPGQPGMKGDRGLPGARGEAG
IPGPQGPPGEPGEVGIGKPGPMGPPGPAGIPGAKGLPGPAGLPGSPGLPGFGKPGLPGMK
GHRGPEGPPGFPGPKGDQGPAGVPGELGPAGPQGNMGPQGLKGLPGENGLPGPKGDMGPV
GPAGFPGAKGERGLPGLDGKPGYPGEQGLPGPKGHPGLPGQKGDTGHAGHPGLPGPVGPQ
GVKGVPGINGEPGPRGPSGIPGVRGPIGPPGMPGAPGAKGEAGAPGLPGPAGIVTKGLRG
PMGPLGPPGPKGNSGEPGLPGPPGPPGPPGQSTIPEGYVKGESRELSGMSFMKAGANQAL
TGMPVSAFTVILSKAYPGATVPIKFDKILYNRQQHYDPRTGIFTCRIPGLYYFSYHVHAK
GTNVWVALYKNGSPVMYTYDEYQKGYLDQASGSAVIDLMENDQVWLQLPNSESNGLYSSE
YVHSSFSGFLFAQI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen alpha-1(X) chain contains a PF01391 domain.

Collagen alpha-1(X) chain contains a PF01391 domain.

Collagen alpha-1(X) chain contains a PF01391 domain.

Collagen alpha-1(X) chain contains a PF01391 domain.

Collagen alpha-1(X) chain contains a PF01391 domain.

Collagen alpha-1(X) chain contains a PF01391 domain.

Collagen alpha-1(X) chain contains a PF01391 domain.

Collagen alpha-1(X) chain contains a PF01391 domain.

Collagen alpha-1(X) chain contains a PF00386 domain.

Collagen alpha-1(X) chain is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage..