cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C)

UniProt : B2R9Q8, P49767, UniProt ID: B2R9Q8_HUMAN, VEGFC_HUMAN,

cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C)

Homo sapiens

MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQL
RSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILK
SIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSY
LSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAAN
KTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCAC
ECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C) contains a PF00341 domain.

cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C) contains a PF03128 domain.

cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C) contains a PF03128 domain.

cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C) contains a PF03128 domain.

cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C) contains a PF03128 domain.

cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C) contains a PF03128 domain.

cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C) is proteolytically cut by proprotein convertase 7 (S08.077) cleavage. IIRR-SLPA.

cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C) is proteolytically cut by proprotein convertase 5 (S08.076) cleavage. IIRR-SLPA.

cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C) is proteolytically cut by PACE4 proprotein convertase (S08.075) cleavage. IIRR-SLPA.

cDNA, FLJ94513, Homo sapiens vascular endothelial growth factor C (VEGFC), mRNA (Vascular endothelial growth factor C) is proteolytically cut by furin (S08.071) cleavage. IIRR-SLPA.