cDNA, FLJ93104, highly similar to Homo sapiens pentaxin-related

UniProt : B2R6T6, UniProt ID: B2R6T6_HUMAN,

cDNA, FLJ93104, highly similar to Homo sapiens pentaxin-related

Homo sapiens

MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLF
IMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDEL
LQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCE
TAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYL
SYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGH
IVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIR
GNIVGWGVTEIQPHGGAQYVS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93104, highly similar to Homo sapiens pentaxin-related contains a PF00354 domain.

cDNA, FLJ93104, highly similar to Homo sapiens pentaxin-related is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..