Baculoviral IAP repeat-containing protein 2

UniProt : Q13490, UniProt ID: BIRC2_HUMAN,

Baculoviral IAP repeat-containing protein 2

Homo sapiens

MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Baculoviral IAP repeat-containing protein 2 contains a PF00097 domain.

Baculoviral IAP repeat-containing protein 2 contains a PF00653 domain.

Baculoviral IAP repeat-containing protein 2 contains a PF00653 domain.

Baculoviral IAP repeat-containing protein 2 contains a PF00653 domain.

Baculoviral IAP repeat-containing protein 2 contains a PF00619 domain.

Baculoviral IAP repeat-containing protein 2 is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. MHKT-ASQR.

Baculoviral IAP repeat-containing protein 2 is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. PMRN-SFAH.

Baculoviral IAP repeat-containing protein 2 is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. PNPL-NSRA.