Furin1-X

UniProt : Q9Y1A6, UniProt ID: Q9Y1A6_LYMST,

Furin1-X

Lymnaea stagnalis

MHGSIHVVKVLVFRFFLLLETVVGKHFTDLWAVHVKGGEEVAKAVAVRHGFIYKGQIMPD
YYHFQHRKVAKRSTFASIHYHQPLAEDSDVLWVEQQVAKSRQKRSVHFNDPKWPLMWYLN
RGSGLDMNVRKAWDMGYTGKGVVVTILDDGIEKDHPDLYRNYDENASYDVNGHDPDPQPR
YDLSNENRHGTRCAGEVAAQADNHVCSVGVAFNAKIGGVRMLDGDVTDSVEAQSLGLNPQ
HIHIYSASWGPDDDGRTVDGPATLARKAFYDGITKGRGGLGSIFVWASGNGGRDSDNCNC
DGYTNSIYTLSISSATENGNIPWYSEACSSTLATTYSSGSGGEKQIVTTDLRKGCTETHT
GTSASAPLAAGLIALALEANPSLTWRDMQHIVVETAKPHDLNADDWVINGVGKRVSHSFG
FGLMDAAAMVSLARNWTSVPAQHICEIRSPDHNSRTIPMNGRVSVLLNTDGCDGTVNHVK
YLEHVQARITMTSSKRGEIRIFLSSPSLTRSTLLARRGKDVSREGFNNWAFMTTHNWGEG
PKGDWTLEIENGISSSRPLKLRDWVLVLYGTDSPPRKSPTSIRSTYNEYGPVRPHTEVKG
PNSFHKDYEMESEEDYDQETTPITTSTTTRTTPATPYHGGQHQYYPWSGHQNRQQATPIT
SNSPRKNLNSFYFWETYYPAYASQPNHAHSSDSQHRHNHPEHTCVYETLAKKSNISAIQY
MRKKRPELTPAELKEWTLVMMGTSGHHMKRNGSQASSHGGEQIFKCAGVTTNGICIECKP
GFFKMGDNCVAHCPQHYYGSVQAVQMAASSKMTTTKPLLHTQGVCKPCHDTCLNCKGSTA
TDCFQCASGFERKGELCEKKMIWDLLDPDVMKHLAWAIILCIAAILLFSVVFGILQARDR
GRLCWKSKPNYVPDWGRGHYDGVTPNYAMQDSDNEAEFSPPAKTQTLFPQTIGFKHHHCN
SRTAQNV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Furin1-X contains a PF00082 domain.

Furin1-X contains a PF01483 domain.

Furin1-X is proteolytically cut by furin (S08.071) cleavage. RQKR-SVHF.