Hepatocyte growth factor-like protein

UniProt : P26927, UniProt ID: HGFL_HUMAN,

Hepatocyte growth factor-like protein

Homo sapiens

MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC
GPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRG
TMATTVGGLPCQAWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQS
CGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYC
RNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGKGEGYRGTANTTTA
GVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTLRPGMRAAFCYQIRR
CTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPHAQLEENFCR
NPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEKCGKRVDRLDQRRS
KLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSSCHMPLTGYEVWLGT
LFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGT
KCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMCTEGLLAPVGACEGD
YGGPLACFTHNCWVLEGIIIPNRVCARSRWPAVFTRVSVFVDWIHKVMRLG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hepatocyte growth factor-like protein contains a PF00051 domain.

Hepatocyte growth factor-like protein contains a PF00089 domain.

Hepatocyte growth factor-like protein contains a PF00051 domain.

Hepatocyte growth factor-like protein contains a PF00051 domain.

Hepatocyte growth factor-like protein contains a PF00051 domain.

Hepatocyte growth factor-like protein contains a PF00024 domain.

Hepatocyte growth factor-like protein is proteolytically cut by plasma kallikrein (S01.212) cleavage. SKLR-VVGG.

Hepatocyte growth factor-like protein is proteolytically cut by macrophage-stimulating protein (S01.975) cleavage. SKLR-VVGG.