Gag polyprotein (Fragment)

UniProt : P03343, UniProt ID: GAG_MMTVG,

Gag polyprotein (Fragment)

Mouse mammary tumor virus (strain GR)

MGVSGSKGQKLFVSVLQRLLSERGLHVKESSTIEFYQFLIKVSLGFPKKEDLNLQDWKRV
GREMKKYAADDGTDSIPKQAYPIWLQLREILTEQSDLVLLSAEAKSVTEEELEEGLTGLL
SASSQEKTYGTRGTAYAEIDTEADKLSEHIYDEPYEEKEKADKNEEKDHVRKVKKIVQRK
ENSEHKRKEKDQKAFLATDWNDDDLSPEDWDNLEEQAAHYHDDDELILPVKRKVVKKKPL
ALRRKPLPPVGFAGAMAEAREKGDLTFTFPVVFMGESDDDDTPVWEPLPLKTLKELQSAV
RTMGPSAPYTLEVVDMVASQWLTPSDWHQTARATLSPGDYVLWRTEYEEKSKE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gag polyprotein (Fragment) contains a PF00607 domain.

Gag polyprotein (Fragment) contains a PF02337 domain.

Gag polyprotein (Fragment) is proteolytically cut by mouse mammary tumor virus retropepsin (A02.010) cleavage. ELIL-PVKR.