Genome polyprotein

UniProt : P09814, UniProt ID: POLG_TVMV,

Genome polyprotein

Tobacco vein mottling virus

MAATMIFGSFTHDLLGKAMSTIHSAVTAEKDIFSSIKERLERKRHGKICRMKNGSIYIKA
ASSTKVEKINAAAKKLADDKAAFLKAQPTIVDKIIVNEKIQVVEAEEVHKREDVQTVFFK
KTKKRAPKLRATCSSSGLDNLYNAVANIAKASSLRVEVIHKKRVCGEFKQTRFGRALFID
VAHAKGHRRRIDCRMHRREQRTMHMFMRKTTKTEVRSKHLRKGDSGIVLLTQKIKGHLSG
VRDEFFIVRGTCDDSLLEARARFSQSITLRATHFSTGDIFWKGFNASFQEQKAIGLDHTC
TSDLPVEACGHVAALMCQSLFPCGKITCKRCIANLSNLDFDTFSELQGDRAMRILDVMRA
RFPSFTHTIRFLHDLFTQRRVTNPNTAAFREILRLIGDRNEAPFAHVNRLNEILLLGSKA
NPDSLAKASDSLLELARYLNNRTENIRNGSLKHFRNKISSKAHSNLALSCDNQLDQNGNF
LWGLAGIAAKRFLNNYFETIDPEQGYDKYVIRKNPNGERKLAIGNFIISTNLEKLRDQLE
GESIARVGITEECVSRKDGNYRYPCCCVTLEDGSPMYSELKMPTKNHLVIGNSGDPKYLD
LPGEISNLMYIAKEGYCYINIFLAMLVNVDEANAKDFTKRVRDESVQKLGKWPSLIDVAT
ECALLSTYYPAAASAELPRLLVDHAQKTIHVVDSYGSLNTGYHILKANTVSQLEKFASNT
LESPMAQYKVGGLVYSENNDASAVKALTQAIFRPDVLSELIEKEPYLMVFALVSPGILMA
MSNSGALEFGISKWISSDHSLVRMASILKTLASKVSVADTLALQKHIMRQNANFLCGELI
NGFQKKKSYTHATRFLLMISEENEMDDPVLNAGYRVLEASSHEIMEKTYLALLETSWSDL
SLYGKFKSIWFTRKHFGRYKAELFPKEQTDLQGRYSNSLRFHYQSTLKRLRNKGSLCRER
FLESISSARRRTTCAVFSLLHKAFPDVLKFINTLVIVSLSMQIYYMLVAIIHEHRAAKIK
SAQLEERVLEDKTMLLYDDFKAKLPEGSFEEFLEYTRQRDKEVYEYLMMETTEIVEFQAK
NTGQASLERIIAFVSLTLMLFDNERSDCVYKILTKFKGILGSVENNVRFQSLDTIVPTQE
EKNMVIDFELDSDTAHTPQMQEQTFSDWWSNQIANNRVVPHYRTEGYFMQFTRNTASAVS
HQIAHNEHKDIILMGAVGSGKSTGLPTNLCKFGGVLLLEPTRPLAENVTKQMRGSPFFAS
PTLRMRNLSTFGSSPITVMTTGFALHFFANNVKEFDRYQFIIFDEFHVLDSNAIAFRNLC
HEYSYNGKIIKVSATPPGRECDLTTQYPVELLIEEQLSLRDFVDAQGTDAHADVVKKGDN
ILVYVASYNEVDQLSKMLNERGFLVTKVDGRTMKLGGVEIITKGSSIKKHFIVATNIIEN
GVTLDVDVVVDFGLKVVPNLDSDNRLVSYCKIPISLGERIQRFGRVGRNKPGVALRIGET
IKGLVEIPSMIATEAAFLCFVYGLPVTTQNVSTSILSQVSVRQARVMCQFELPIFYTAHL
VRYDGAMHPAIHNALKRFKLRDSEINLNTLAIPTSSSKTWYTGKCYKQLVGRLDIPDEIK
IPFYTKEVPEKVPEQIWDVMVKFSSDAGFGRMTSAAACKVAYTLQTDIHSIQRTVQIIDR
LLENEMKKRNHFNLVVNQSCSSHFMSLSSIMASLRAHYAKNHTGQNIEILQKAKAQLLEF
SNLAIDPSTTEALRDFGYLEAVRFQSESEMARGLKLSGHWKWSLISRDLIVVSGVGIGLG
CMLWQFFKEKMHEPVKFQGKSRRRLQFRKARDDKMGYIMHGEGDTIEHFFGAAYTKKGKS
KGKTHGAGTKAHKFVNMYGVSPDEYSYVRYLDPVTGATLDESPMTDLNIVQEHFGEIRRE
AILADAMSPQQRNKGIQAYFVRNSTMPILKVDLTPHIPLKVCESNNIAGFPEREGELRRT
GPTETLPFDALPPEKQEVAFESKALLKGVRDFNPISACVWLLENSSDGHSERLFGIGFGP
YIIANQHLFRRNNGELTIKTMHGEFKVKNSTQLQMKPVEGRDIIVIKMAKDFPPFPQKLK
FRQPTIKDRVCMVSTNFQQKSVSSLVSESSHIVHKEDTSFWQHWITTKDGQCGSPLVSII
DGNILGIHSLTHTTNGSNYFVEFPEKFVATYLDAADGWCKNWKFNADKISWGSFTLVEDA
PEDDFMAKKTVAAIMDDLVRTQGEKRKWMLEAAHTNIQPVAHLQSQLVTKHIVKGRCKMF
ALYLQENADARDFFKSFMGAYGPSHLNKEAYIKDIMKYSKQIVVGSVDCDTFESSLKVLS
RKMKEWGFENLEYVTDEQTIKNALNMDAAVGALYSGKKKQYFEDLSDDAVANLVQKSCLR
LFKNKLGVWNGSLKAELRPFEKLIENKTRTFTAAPIETLLGGKVCVDDFNNHFYSKHIQC
PWSVGMTKFYGGWNELLGKLPDGWVYCDADGSQFDSSLSPYLINAVLRLRLSSMEEWDVG
QKMLQNLYTEIVYTPISTPDGTIVKKFKGNNSGQPSTVVDNTLMVVLAMYYALSKLGVDI
NSQEDVCKFFANGDDLIIAISPELEHVLDGFQQHFSDLGLNYDFSSRTRDKKELWFMSHR
ALSKDGILIPKLEPERIVSILEWDRSAEPHHRLEAICASMIEAWGYTDLLQNIRRFYKWT
IEQEPYRSLAEQGLAPYLSEVALRRLYTSQIATDNELTDYYKEILANNEFLRETVRFQSD
TVDAGKDKARDQKLADKPTLAIDRTKDKDVNTGTSGTFSIPRLKKAAMNMKLPKVGGSSV
VNLDHLLTYKPAQEFVVNTRATHSQFKAWHTNVMAELELNEEQMKIVLNGFMIWCIENGT
SPNISGVWTMMDGDEQVEYPIEPMVKHANPSLRQIMKHFSNLAEAYIRMRNSEQVYIPRY
GLQRGLVDRNLAPFAFDFFEVNGATPVRAREAHAQMKAAALRNSQQRMFCLDGSVSGQEE
NTERHTVDDVNAQMHHLLGVKGV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Genome polyprotein contains a PF08440 domain.

Genome polyprotein contains a PF01577 domain.

Genome polyprotein contains a PF00863 domain.

Genome polyprotein contains a PF00851 domain.

Genome polyprotein contains a PF00270 domain.

Genome polyprotein contains a PF00271 domain.

Genome polyprotein contains a PF00767 domain.

Genome polyprotein contains a PF00680 domain.

Genome polyprotein is proteolytically cut by potyvirus P1 peptidase (S30.001) cleavage. RARF-SQSI.

Genome polyprotein is proteolytically cut by tobacco vein mottling virus-type NIa peptidase (C04.003) cleavage. VRFQ-SDTV.

Genome polyprotein is proteolytically cut by tobacco vein mottling virus-type NIa peptidase (C04.003) cleavage. VRTQ-GEKR.

Genome polyprotein is proteolytically cut by tobacco vein mottling virus-type NIa peptidase (C04.003) cleavage. VRFQ-SESE.

Genome polyprotein is proteolytically cut by tobacco vein mottling virus-type NIa peptidase (C04.003) cleavage. VRFQ-SLDT.