Peptidyl-prolyl cis-trans isomerase FKBP1A
|
UniProt : P62942, UniProt ID: FKB1A_HUMAN, Peptidyl-prolyl cis-trans isomerase FKBP1A Homo sapiens MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Peptidyl-prolyl cis-trans isomerase FKBP1A contains a PF00254 domain.
Peptidyl-prolyl cis-trans isomerase FKBP1A is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..