CG7105-PA (RH15319p) (Proctolin)

UniProt : Q9VLV9, UniProt ID: Q9VLV9_DROME,

CG7105-PA (RH15319p) (Proctolin)

Drosophila melanogaster

MGVPRSHGTGIGCGSGHRWLLVWMTVLLLVVPPHLVDGRYLPTRSHGDDLDKLRELMLQI
LELSNEDPQQQQQQQQQQQHPQLRLHNEATGGSSSSSNINNPRVSNGNSNAAWLQKLSAM
GALDELGGDGARFGPNYGRY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CG7105-PA (RH15319p) (Proctolin) is proteolytically cut by dipeptidyl-peptidase III (M49.001) cleavage. --RY-LPT-.