OSM protein (Oncostatin M, isoform CRA_a) (Fragment)

UniProt : P13725, Q6FHP8, UniProt ID: ONCM_HUMAN, Q6FHP8_HUMAN,

OSM protein (Oncostatin M, isoform CRA_a) (Fragment)

Homo sapiens

MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI
RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKA
QDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTP
ASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK
GKRLMTRGQLPR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

OSM protein (Oncostatin M, isoform CRA_a) (Fragment) contains a PF01291 domain.

OSM protein (Oncostatin M, isoform CRA_a) (Fragment) is proteolytically cut by () cleavage. NRSR-RHSP.