Amelogenin
|
UniProt : Q9Z0K9, UniProt ID: AMEL_CAVPO, Amelogenin Cavia porcellus MGTWILFACLLGTAFAMPLPPHPGHPGYINFSYEKSHSNAINIDRTALVLTPLKWYQSMI RQPYPSYGYESMGGWVHHQVIPVLSQQHPPSHTTLPPHHHIPVGPAQQPVVPQQPLMPVP GHHSMTPNQHHQPNLPPTSQQPFQQPFPTQPVQPQHHQPIQPIQPIQPIQPIQPIQPQSP LHPIQPLPPQQALPPMFSMQPIAPLLPDLPLEAWPATDKTKREEVD The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Amelogenin contains a PF02948 domain.
Amelogenin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. MGGW-VHHQ.