Isoform 2 of Amelogenin, X isoform

UniProt : Q99217, UniProt ID: Q99217-2,

Isoform 2 of Amelogenin, X isoform

Homo sapiens

MGTWILFACLLGAAFAMPVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPT
HTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQP
HQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Amelogenin, X isoform contains a PF02948 domain.

Isoform 2 of Amelogenin, X isoform is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. MGGW-LHHQ.