PMAP: SubstrateDB : Amelogenin, X isoform

Amelogenin, X isoform

UniProt : Q99217, UniProt ID: AMELX_HUMAN,

Amelogenin, X isoform

Homo sapiens

MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGW
LHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLP
PPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWP
STDKTKREEVD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Amelogenin, X isoform contains a PF02948 domain.

Amelogenin, X isoform is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. NFSY-EVLT.

Amelogenin, X isoform is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. MGGW-LHHQ.

Amelogenin, X isoform is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. PMFP-MQPL.

Amelogenin, X isoform is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. PMLP-DLTL.

Amelogenin, X isoform is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. PDLT-LEAW.

Amelogenin, X isoform is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. DLTL-EAWP.

Amelogenin, X isoform is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. EAWP-STDK.