Isoform 3 of Amelogenin

UniProt : P45561, UniProt ID: P45561-3,

Isoform 3 of Amelogenin

Sus scrofa

MGTWIFFACLLGASLAMPLPPHPGHPGYINFSYEVLTPLKWYQNMIRHPYTSYGYEPMGG
WLHHQIIPVVSQQTPQSHALQPHHHIPMVPAQQPGIPQQPMMPLPGQHSMTPTQHHQPNL
PLPAQQPFQPQPVQPQPHQPLQPQSPMHPIQPLLPQPPLPPMFSMQSLLPDLPLEAWPAT
DKTKREEVD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 3 of Amelogenin contains a PF02948 domain.

Isoform 3 of Amelogenin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. MGGW-LHHQ.

Isoform 3 of Amelogenin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. PMFS-MQSL.

Isoform 3 of Amelogenin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. PIQP-LLPQ.

Isoform 3 of Amelogenin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. LPLP-AQQP.

Isoform 3 of Amelogenin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. PNLP-LPAQ.

Isoform 3 of Amelogenin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. PPMF-SMQS.

Isoform 3 of Amelogenin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. PPMF-SMQS.

Isoform 3 of Amelogenin is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. QSHA-LQPH.