Cyclin-dependent kinase 5, regulatory subunit 1 (P35) (Cyclin-dependent kinase 5, regulatory subunit 1 (P35), isoform CRA_a)

UniProt : Q15078, Q5U0G3, UniProt ID: CD5R1_HUMAN, Q5U0G3_HUMAN,

Cyclin-dependent kinase 5, regulatory subunit 1 (P35) (Cyclin-dependent kinase 5, regulatory subunit 1 (P35), isoform CRA_a)

Homo sapiens

MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cyclin-dependent kinase 5, regulatory subunit 1 (P35) (Cyclin-dependent kinase 5, regulatory subunit 1 (P35), isoform CRA_a) contains a PF03261 domain.

Cyclin-dependent kinase 5, regulatory subunit 1 (P35) (Cyclin-dependent kinase 5, regulatory subunit 1 (P35), isoform CRA_a) is proteolytically cut by neprilysin (M13.001) cleavage. LSTF-AQPP.

Cyclin-dependent kinase 5, regulatory subunit 1 (P35) (Cyclin-dependent kinase 5, regulatory subunit 1 (P35), isoform CRA_a) is proteolytically cut by calpain-1 (C02.001) cleavage. LSTF-AQPP.

Cyclin-dependent kinase 5, regulatory subunit 1 (P35) (Cyclin-dependent kinase 5, regulatory subunit 1 (P35), isoform CRA_a) is proteolytically cut by calpain-1 (C02.001) cleavage. LSTF-AQPP.

Cyclin-dependent kinase 5, regulatory subunit 1 (P35) (Cyclin-dependent kinase 5, regulatory subunit 1 (P35), isoform CRA_a) is proteolytically cut by calpain-1 (C02.001) cleavage. LSTF-AQPP.