Cyclin-dependent kinase 5 activator 2

UniProt : Q13319, UniProt ID: CD5R2_HUMAN,

Cyclin-dependent kinase 5 activator 2

Homo sapiens

MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVL
ISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKP
LAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQ
ASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVY
LLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRL
IQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAARDSCAAGTKH
WTMNLDR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cyclin-dependent kinase 5 activator 2 contains a PF03261 domain.

Cyclin-dependent kinase 5 activator 2 is proteolytically cut by calpain-2 (C02.002) cleavage. QQRN-RENL.

Cyclin-dependent kinase 5 activator 2 is proteolytically cut by calpain-2 (C02.002) cleavage. ENLL-RKGR.

Cyclin-dependent kinase 5 activator 2 is proteolytically cut by calpain-2 (C02.002) cleavage. LRKG-RDPP.