Apolipoprotein C-II

UniProt : P02655, UniProt ID: APOC2_HUMAN,

Apolipoprotein C-II

Homo sapiens

MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYE
KTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Apolipoprotein C-II contains a PF05355 domain.

Apolipoprotein C-II is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. PALF-LVLL.

Apolipoprotein C-II is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. AAQN-LYEK.

Apolipoprotein C-II is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. AAQN-LYEK.

Apolipoprotein C-II is proteolytically cut by () cleavage. QPQQ-DEMP.