PMAP: SubstrateDB : Bcl2 antagonist of cell death

Bcl2 antagonist of cell death

UniProt : Q61337, UniProt ID: BAD_MOUSE,

Bcl2 antagonist of cell death

Mus musculus

MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASAT
DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
AGWTRIIQSWWDRNLGKGGSTPSQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Bcl2 antagonist of cell death is proteolytically cut by caspase-3 (C14.003) cleavage. GEDA-SATDR.

Bcl2 antagonist of cell death is proteolytically cut by caspase-3 (C14.003) cleavage. FEPS-EQED.

Bcl2 antagonist of cell death is proteolytically cut by granzyme B, rodent-type (S01.136) cleavage..

Bcl2 antagonist of cell death is proteolytically cut by caspase-10 (C14.011) cleavage..

Bcl2 antagonist of cell death is proteolytically cut by caspase-7 (C14.004) cleavage..

Bcl2 antagonist of cell death is proteolytically cut by caspase-2 (C14.006) cleavage..

Bcl2 antagonist of cell death is proteolytically cut by caspase-3 (C14.003) cleavage. EQED-ASAT.

Bcl2 antagonist of cell death is proteolytically cut by caspase-3 (C14.003) cleavage. SATD-RGLG.