MARCKS-like 1

UniProt : B2KGE6, P28667, UniProt ID: B2KGE6_MOUSE, MRP_MOUSE,

MARCKS-like 1

Mus musculus

MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVRSNGDLTPKGEGESPPVNGTDEAAGA
TGDAIEPAPPSQEAEAKGEVAPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASS
PTEEEQEQGEMSACSDEGTAQEGKAAATPESQEPQAKGAEASAASKEGDTEEEAGPQAAE
PSTPSGPESGPTPASAEQNE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

MARCKS-like 1 contains a PF02063 domain.

MARCKS-like 1 is proteolytically cut by leishmanolysin (M08.001) cleavage. KPFK-LSGL.

MARCKS-like 1 is proteolytically cut by leishmanolysin (M08.001) cleavage. KKFS-FKKP.

MARCKS-like 1 is proteolytically cut by leishmanolysin (M08.001) cleavage. SGLS-FKRN.