Natriuretic peptide type A

UniProt : B0BMW5, P01161, UniProt ID: ANF_RAT, B0BMW5_RAT,

Natriuretic peptide type A

Rattus norvegicus

MGSFSITKGFFLFLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKMPVEDEVMPPQ
ALSEQTDEAGAALSSLSEVPPWTGEVNPSQRDGGALGRGPWDPSDRSALLKSKLRALLAG
PRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Natriuretic peptide type A contains a PF00212 domain.

Natriuretic peptide type A is proteolytically cut by oligopeptidase B (S09.010) cleavage. RSLR-RSSC.

Natriuretic peptide type A is proteolytically cut by oligopeptidase B (S09.010) cleavage. SLRR-SSCF.

Natriuretic peptide type A is proteolytically cut by oligopeptidase B (S09.010) cleavage. FGGR-IDRI.

Natriuretic peptide type A is proteolytically cut by oligopeptidase B (S09.010) cleavage. NSFR-YRR-.

Natriuretic peptide type A is proteolytically cut by oligopeptidase B (S09.010) cleavage. RSLR-RSSC.

Natriuretic peptide type A is proteolytically cut by oligopeptidase B (S09.010) cleavage. SLRR-SSCF.

Natriuretic peptide type A is proteolytically cut by oligopeptidase B (S09.010) cleavage. FGGR-IDRI.

Natriuretic peptide type A is proteolytically cut by oligopeptidase B (S09.010) cleavage. NSFR-YRR-.

Natriuretic peptide type A is proteolytically cut by insulysin (M16.002) cleavage. RSLR-RSSC.

Natriuretic peptide type A is proteolytically cut by insulysin (M16.002) cleavage. RSSC-FGGR.

Natriuretic peptide type A is proteolytically cut by insulysin (M16.002) cleavage. GRID-RIGA.

Natriuretic peptide type A is proteolytically cut by insulysin (M16.002) cleavage. GCNS-FRYR.

Natriuretic peptide type A is proteolytically cut by neprilysin (M13.001) cleavage. RSSC-FGGR.