CDE1-binding protein CDEBP (Putative uncharacterized protein)

UniProt : Q64348, UniProt ID: Q64348_MOUSE,

CDE1-binding protein CDEBP (Putative uncharacterized protein)

Mus musculus

MAATGTAAAAATGKLLVLLLLGLTAPAAALAGYIEALAANAGTGFAVAEPQIAMFCGKLN
MHVNIQTGKWEPDPTGTKSCLGTKEEVLQYCQEIYPELQITNVMEANQPVNIDSWCRRDK
RQCKSHIVIPFKCLVGEFVSDVLLVPDNCQFFHQERMEVCEKHQRWHTLVKEACLTEGLT
LYSYGMLLPCGVDQFHGTEYVCCPQTKTVDSDSTMSKEEEEEEEDEEDEEEDYDLDKSEF
PTEADLEDFTEAAADEEEEDEEEGEEVVEDRDYYYDPFKGDDYNEENPTEPSSEGTISDK
EIVHDVKVPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAE
LQAKNLPKTERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRIALENYL
AALQSDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVI
EERRNQSLSLLYKVPYVAQEIQEEIDELLQEQRADMDQFTSSISENPVDVRVSSEESEEI
PPFHPLHPFPSLSENEGSGMAEQDGGLIGAEEKVINSKNKMDENMVIDETLDVKEMIFNA
ERVGGLEEEPESVGPLREDFSLSSNALIGLLVIAVAIATVIVISLVMLRKRQYGTISHGI
VEVDPMLTPEERHLNKMQNHGYENPTYKYLEQMQI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CDE1-binding protein CDEBP (Putative uncharacterized protein) contains a PF02177 domain.

CDE1-binding protein CDEBP (Putative uncharacterized protein) is proteolytically cut by beta-site APP-cleaving enzyme 1 () cleavage..