Hepatocyte growth factor activator (HGF activator)

UniProt : Q04756, Q53X47, UniProt ID: HGFA_HUMAN, Q53X47_HUMAN,

Hepatocyte growth factor activator (HGF activator)

Homo sapiens

MGRWAWVPSPWPPPGLGPFLLLLLLLLLLPRGFQPQPGGNRTESPEPNATATPAIPTILV
TSVTSETPATSAPEAEGPQSGGLPPPPRAVPSSSSPQAQALTEDGRPCRFPFRYGGRMLH
ACTSEGSAHRKWCATTHNYDRDRAWGYCVEATPPPGGPAALDPCASGPCLNGGSCSNTQD
PQSYHCSCPRAFTGKDCGTEKCFDETRYEYLEGGDRWARVRQGHVEQCECFGGRTWCEGT
RHTACLSSPCLNGGTCHLIVATGTTVCACPPGFAGRLCNIEPDERCFLGNGTGYRGVAST
SASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDNDERPWCYVVKDSALSWE
YCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHP
WLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIE
KYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGW
GHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGG
PLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVAPS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hepatocyte growth factor activator (HGF activator) contains a PF00089 domain.

Hepatocyte growth factor activator (HGF activator) contains a PF00051 domain.

Hepatocyte growth factor activator (HGF activator) contains a PF00040 domain.

Hepatocyte growth factor activator (HGF activator) contains a PF00039 domain.

Hepatocyte growth factor activator (HGF activator) contains a PF00008 domain.

Hepatocyte growth factor activator (HGF activator) contains a PF00008 domain.

Hepatocyte growth factor activator (HGF activator) is proteolytically cut by kallikrein hK5 (S01.017) cleavage. LRPR-IIGG.

Hepatocyte growth factor activator (HGF activator) is proteolytically cut by thrombin (S01.217) cleavage. LRPR-IIGG.

Hepatocyte growth factor activator (HGF activator) is proteolytically cut by kallikrein hK5 (S01.017) cleavage. LRPR-IIGG.

Hepatocyte growth factor activator (HGF activator) is proteolytically cut by thrombin (S01.217) cleavage. LRPR-IIGG.

Hepatocyte growth factor activator (HGF activator) is proteolytically cut by plasma kallikrein (S01.212) cleavage. SLTR-VQLS.

Hepatocyte growth factor activator (HGF activator) is proteolytically cut by thrombin (S01.217) cleavage. LRPR-IIGG.

Hepatocyte growth factor activator (HGF activator) is proteolytically cut by kallikrein hK5 (S01.017) cleavage. LRPR-IIGG.

Hepatocyte growth factor activator (HGF activator) is proteolytically cut by thrombin (S01.217) cleavage. LRPR-IIGG.

Hepatocyte growth factor activator (HGF activator) is proteolytically cut by plasma kallikrein (S01.212) cleavage. SLTR-VQLS.

Hepatocyte growth factor activator (HGF activator) is proteolytically cut by thrombin (S01.217) cleavage. LRPR-IIGG.

Hepatocyte growth factor activator (HGF activator) is proteolytically cut by kallikrein hK4 (S01.251) cleavage. LRPR-IIGG.