cDNA FLJ77045, highly similar to Homo sapiens arginine/serine-rich coiled-coil 1 (RSRC1), mRNA

UniProt : A8K2R9, Q96IZ7, UniProt ID: A8K2R9_HUMAN, RSRC1_HUMAN,

cDNA FLJ77045, highly similar to Homo sapiens arginine/serine-rich coiled-coil 1 (RSRC1), mRNA

Homo sapiens

MGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRKSRSKSRSWSRDLQPRSH
SYDRRRRHRSSSSSSYGSRRKRSRSRSRGRGKSYRVQRSRSKSRTRRSRSRPRLRSHSRS
SERSSHRRTRSRSRDRERRKGRDKEKREKEKDKGKDKELHNIKRGESGNIKAGLEHLPPA
EQAKARLQLVLEAAAKADEALKAKERNEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSF
VQQTFRSSKEVKKSVEPSEVKQATSTSGPASAVADPPSTEKEIDPTSIPTAIKYQDDNSL
AHPNLFIEKADAEEKWFKRLIALRQERLMGSPVA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ77045, highly similar to Homo sapiens arginine/serine-rich coiled-coil 1 (RSRC1), mRNA is proteolytically cut by caspase () cleavage. IESD-SFVQ.