Delta-like 1 (Drosophila)

UniProt : Q6PFV7, UniProt ID: Q6PFV7_MOUSE,

Delta-like 1 (Drosophila)

Mus musculus

MGRRSALALAVVSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGSGPPCACRTFFR
VCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFS
LIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRTDLRYSYRFVCDE
HYYGEGCSVFCRPRDDAFGHFTCGDRGEKMCDPGWKGQYCTDPICLPGCDDQHGYCDKPG
ECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNG
ATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSPCKNGASCTDLEDSFSCTCPPGFYGK
VCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPLGFSGFNCEKKMDLCGSSPCSNGAKCV
DLGNSYLCRCQAGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGKNCSAP
VSRCEHAPCHNGATCHQRGQRYMCECAQGYGGPNCQFLLPEPPPGPMVVDLSERHMESQG
GPFPWVAVCAGVVLVLLLLLGCAAVVVCVRLKLQKHQPPPEPCGGETETMNNLANCQREK
DVSVSIIGATQIKNTNKKADFHGDHGAEKSSFKVRYPTVDYNLVRDLKGDEATVRDTHSK
RDTKCQSQSSAGEEKIAPTLRGGEIPDRKRPESVYSTSKDTKYQSVYVLSAEKDECVIAT
EV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Delta-like 1 (Drosophila) contains a PF07657 domain.

Delta-like 1 (Drosophila) contains a PF01414 domain.

Delta-like 1 (Drosophila) contains a PF00008 domain.

Delta-like 1 (Drosophila) contains a PF00008 domain.

Delta-like 1 (Drosophila) contains a PF00008 domain.

Delta-like 1 (Drosophila) contains a PF00008 domain.

Delta-like 1 (Drosophila) contains a PF00008 domain.

Delta-like 1 (Drosophila) contains a PF00008 domain.

Delta-like 1 (Drosophila) is proteolytically cut by ADAM9 peptidase (M12.209) cleavage..

Delta-like 1 (Drosophila) is proteolytically cut by ADAM12 peptidase (M12.212) cleavage..

Delta-like 1 (Drosophila) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..

Delta-like 1 (Drosophila) is proteolytically cut by ADAM9 peptidase (M12.209) cleavage..

Delta-like 1 (Drosophila) is proteolytically cut by ADAM12 peptidase (M12.212) cleavage..

Delta-like 1 (Drosophila) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..

Delta-like 1 (Drosophila) is proteolytically cut by ADAM10 peptidase (M12.210) cleavage. SERH-MESQ.

Delta-like 1 (Drosophila) is proteolytically cut by presenilin 1 (A22.001) cleavage..