60S ribosomal protein L10

UniProt : P27635, UniProt ID: RL10_HUMAN,

60S ribosomal protein L10

Homo sapiens

MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQL
SSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFG
KPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADE
FEDMVAEKRLIPDGCGVKYIPNRGPLDKWRALHS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

60S ribosomal protein L10 contains a PF00826 domain.

60S ribosomal protein L10 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. MVSD-EYEQ.

60S ribosomal protein L10 is proteolytically cut by granzyme B, human-type (S01.010) cleavage. FNAD-EFED.