Sodium channel, voltage-gated, type I, beta (Sodium channel beta-1 subunit) (cDNA, FLJ93791, Homo sapiens sodium channel, voltage-gated, type I, beta polypeptide (SCN1B), mRNA)

UniProt : Q07699, Q5TZZ4, UniProt ID: Q5TZZ4_HUMAN, SCN1B_HUMAN,

Sodium channel, voltage-gated, type I, beta (Sodium channel beta-1 subunit) (cDNA, FLJ93791, Homo sapiens sodium channel, voltage-gated, type I, beta polypeptide (SCN1B), mRNA)

Homo sapiens

MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFR
QKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYE
CHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMIY
CYKKIAAATETAAQENASEYLAITSESKENCTGVQVAE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Sodium channel, voltage-gated, type I, beta (Sodium channel beta-1 subunit) (cDNA, FLJ93791, Homo sapiens sodium channel, voltage-gated, type I, beta polypeptide (SCN1B), mRNA) contains a PF00047 domain.

Sodium channel, voltage-gated, type I, beta (Sodium channel beta-1 subunit) (cDNA, FLJ93791, Homo sapiens sodium channel, voltage-gated, type I, beta polypeptide (SCN1B), mRNA) is proteolytically cut by memapsin-2 (A01.004) cleavage. KIHL-EVVD.