Farnesyltransferase, CAAX box, alpha (cDNA FLJ77360, highly similar to Homo sapiens farnesyltransferase, CAAX box, alpha (FNTA), mRNA)

UniProt : P49354, Q53XJ9, UniProt ID: FNTA_HUMAN, Q53XJ9_HUMAN,

Farnesyltransferase, CAAX box, alpha (cDNA FLJ77360, highly similar to Homo sapiens farnesyltransferase, CAAX box, alpha (FNTA), mRNA)

Homo sapiens

MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDS
PSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLT
RDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLR
DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLL
DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIG
RSLQSKHSTENDSPTNVQQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Farnesyltransferase, CAAX box, alpha (cDNA FLJ77360, highly similar to Homo sapiens farnesyltransferase, CAAX box, alpha (FNTA), mRNA) contains a PF01239 domain.

Farnesyltransferase, CAAX box, alpha (cDNA FLJ77360, highly similar to Homo sapiens farnesyltransferase, CAAX box, alpha (FNTA), mRNA) contains a PF01239 domain.

Farnesyltransferase, CAAX box, alpha (cDNA FLJ77360, highly similar to Homo sapiens farnesyltransferase, CAAX box, alpha (FNTA), mRNA) contains a PF01239 domain.

Farnesyltransferase, CAAX box, alpha (cDNA FLJ77360, highly similar to Homo sapiens farnesyltransferase, CAAX box, alpha (FNTA), mRNA) contains a PF01239 domain.

Farnesyltransferase, CAAX box, alpha (cDNA FLJ77360, highly similar to Homo sapiens farnesyltransferase, CAAX box, alpha (FNTA), mRNA) contains a PF01239 domain.

Farnesyltransferase, CAAX box, alpha (cDNA FLJ77360, highly similar to Homo sapiens farnesyltransferase, CAAX box, alpha (FNTA), mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. VSLD-SPSY.