Myocyte-specific enhancer factor 2A

UniProt : Q02078, UniProt ID: MEF2A_HUMAN,

Myocyte-specific enhancer factor 2A

Homo sapiens

MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINE
EFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSML
SPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIG
ATGANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPSSKGMMPPLSEEEELELNTQR
ISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGMLS
LGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQ
QQQQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSP
IVLGRPPNTEDRESPSVKRMRMDAWVT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Myocyte-specific enhancer factor 2A contains a PF00319 domain.

Myocyte-specific enhancer factor 2A is proteolytically cut by caspase-7 (C14.004) cleavage. STTD-LTVP.

Myocyte-specific enhancer factor 2A is proteolytically cut by caspase-7 (C14.004) cleavage. SSYD-GSDR.

Myocyte-specific enhancer factor 2A is proteolytically cut by caspase-7 (C14.004) cleavage. TLTD-SSML.

Myocyte-specific enhancer factor 2A is proteolytically cut by caspase-3 (C14.003) cleavage. TLTD-SSML.