Myocyte enhancer factor 2D (MADS box transcription enhancer factor 2, polypeptide D (Myocyte enhancer factor 2D), isoform CRA_a)

UniProt : Q14814, Q5T9U6, UniProt ID: MEF2D_HUMAN, Q5T9U6_HUMAN,

Myocyte enhancer factor 2D (MADS box transcription enhancer factor 2, polypeptide D (Myocyte enhancer factor 2D), isoform CRA_a)

Homo sapiens

MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRA
SEELDGLFRRYGSTVPAPNFAMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLS
PQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANG
NSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGV
SQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGN
VTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSP
LPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYET
GDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Myocyte enhancer factor 2D (MADS box transcription enhancer factor 2, polypeptide D (Myocyte enhancer factor 2D), isoform CRA_a) contains a PF00319 domain.

Myocyte enhancer factor 2D (MADS box transcription enhancer factor 2, polypeptide D (Myocyte enhancer factor 2D), isoform CRA_a) is proteolytically cut by caspase-7 (C14.004) cleavage. LTED-HLDL.

Myocyte enhancer factor 2D (MADS box transcription enhancer factor 2, polypeptide D (Myocyte enhancer factor 2D), isoform CRA_a) is proteolytically cut by () cleavage..