Myocyte-specific enhancer factor 2D

UniProt : Q63943, UniProt ID: MEF2D_MOUSE,

Myocyte-specific enhancer factor 2D

Mus musculus

MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRA
SEELDGLFRRYGSSVPAPNFAMPVTVPVSNQSSMQFSNPSSSLVTPSLVTSSLTDPRLLS
PQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANG
NSLNKVIPAKSPPPPTHNTQLGAPSRKPDLRVITSQGGKGLMHHLTGDHLDLNNAQRLGV
SQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLPSAELSSLPAFSSPAGLALGN
VTAWQQPQPPQQPQPPQPPQSQPQPPQPQPQQPPQQQPHLVPVSLSNLIPGSPLPHVGAA
LTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGEGLSSPAGGSYETGDRDDGR
GDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Myocyte-specific enhancer factor 2D contains a PF00319 domain.

Myocyte-specific enhancer factor 2D is proteolytically cut by calpain-2 (C02.002) cleavage..

Myocyte-specific enhancer factor 2D is proteolytically cut by caspase-3 (C14.003) cleavage..