Hemojuvelin

UniProt : Q7TQ32, UniProt ID: RGMC_MOUSE,

Hemojuvelin

Mus musculus

MGQSPSPRSPHGSPPTLSTLTLLLLLCGQAHSQCKILRCNAEYVSSTLSLRGGGSPDTPR
GGGRGGLASGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAP
PPARGPALPGAGPAPLTPDPCDYEARFSRLHGRAPGFLHCASFGDPHVRSFHNQFHTCRV
QGAWPLLDNDFLFVQATSSPVSSGANATTIRKITIIFKNMQECIDQKVYQAEVDNLPAAF
EDGSINGGDRPGGSSLSIQTANLGSHVEIRAAYIGTTIIIRQTAGQLSFSIRVAEDVARA
FSAEQDLQLCVGGCPPSQRLSRSERNRRGAIAIDTARRLCKEGLPVEDAYFQSCVFDVSV
SGDPNFTVAAQTALDDARIFLTDLENLHLFPSDAGPPLSPAICLVPLLSALFVLWLCFSK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Hemojuvelin contains a PF06534 domain.

Hemojuvelin contains a PF06535 domain.

Hemojuvelin is proteolytically cut by furin (S08.071) cleavage. RNRR-GAIA.