Envelope glycoprotein (Fragment)

UniProt : Q4VZY8, UniProt ID: Q4VZY8_9VIRU,

Envelope glycoprotein (Fragment)

Lassa virus

MGQIVTFFQEVPHVIEEIMNIDLITLSLLAILKGVYNFATCSFIGLITFLSSVGGSCSVI
YKGSYQLETLELNMETLNMTMPLSCTKNNSHHYIRVGNETGLELTLTNTSILNHKFCNLS
DAHKRNLYDHSLMSIISTFHLSIPNFNQYEAMSCDFNGGKISIQYNLSHAYAGDAAKHCG
TVANGVLQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Envelope glycoprotein (Fragment) contains a PF00798 domain.

Envelope glycoprotein (Fragment) is proteolytically cut by site-1 peptidase (S08.063) cleavage. RRLL-GTFT.