cDNA, FLJ94535, Homo sapiens mitogen-activated protein kinase kinase 7 (MAP2K7),transcript variant B, mRNA (Mitogen-activated protein kinase kinase 7, isoform CRA_c)

UniProt : B2R9S5, O14733, UniProt ID: B2R9S5_HUMAN, MP2K7_HUMAN,

cDNA, FLJ94535, Homo sapiens mitogen-activated protein kinase kinase 7 (MAP2K7),transcript variant B, mRNA (Mitogen-activated protein kinase kinase 7, isoform CRA_c)

Homo sapiens

MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ94535, Homo sapiens mitogen-activated protein kinase kinase 7 (MAP2K7),transcript variant B, mRNA (Mitogen-activated protein kinase kinase 7, isoform CRA_c) contains a PF00069 domain.

cDNA, FLJ94535, Homo sapiens mitogen-activated protein kinase kinase 7 (MAP2K7),transcript variant B, mRNA (Mitogen-activated protein kinase kinase 7, isoform CRA_c) is proteolytically cut by anthrax lethal factor (M34.001) cleavage. HMLG-LPST.

cDNA, FLJ94535, Homo sapiens mitogen-activated protein kinase kinase 7 (MAP2K7),transcript variant B, mRNA (Mitogen-activated protein kinase kinase 7, isoform CRA_c) is proteolytically cut by anthrax lethal factor (M34.001) cleavage. PTLQ-LPLA.