Gag polyprotein

UniProt : O56225, P07567, UniProt ID: GAG_MPMV, O56225_MPMV,

Gag polyprotein

Mason-Pfizer monkey virus

MGQELSQHERYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVG
DCFQDYYNTFGPEKVPVTAFSYWNLIKELIDKKEVNPQVMAAVAQTEEILKSNSQTDLTK
TSQNPDLDLISLDSDDEGAKSSSLQDKGLSSTKKPKRFPVLLTAQTSKDPEDPNPSEVDW
DGLEDEAAKYHNPDWPPFLTRPPPYNKATPSAPTVMAVVNPKEELKEKIAQLEEQIKLEE
LHQALISKLQKLKTGNETVTHPDTAGGLSRTPHWPGQHIPKGKCCASREKEEQIPKDIFP
VTETVDGQGQAWRHHNGFDFAVIKELKTAASQYGATAPYTLAIVESVADNWLTPTDWNTL
VRAVLSGGDHLLWKSEFFENCRDTAKRNQQAGNGWDFDMLTGSGNYSSTDAQMQYDPGLF
AQIQAAATKAWRKLPVKGDPGASLTGVKQGPDEPFADFVHRLITTAGRIFGSAEAGVDYV
KQLAYENANPACQAAIRPYRKKTDLTGYIRLCSDIGPSYQQGLAMAAAFSGQTVKDFLNN
KNKEKGGCCFKCGKKGHFAKNCHEHAHNNAEPKVPGLCPRCKRGKHWANECKSKTDNQGN
PIPPHQGNGWRGQPQAPKQAYGAVSFVPANKNNPFQSLPEPPQEVQDWTSVPPPTQY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gag polyprotein contains a PF00607 domain.

Gag polyprotein contains a PF02337 domain.

Gag polyprotein contains a PF00098 domain.

Gag polyprotein is proteolytically cut by Mason-Pfizer leukemia virus retropepsin (A02.009) cleavage. KDIF-PVTE.

Gag polyprotein is proteolytically cut by Mason-Pfizer leukemia virus retropepsin (A02.009) cleavage. PTVM-AVVN.

Gag polyprotein is proteolytically cut by Mason-Pfizer leukemia virus retropepsin (A02.009) cleavage. PQVM-AAVA.