Putative uncharacterized protein

UniProt : A8K1U7, P12830, UniProt ID: A8K1U7_HUMAN, CADH1_HUMAN,

Putative uncharacterized protein

Homo sapiens

MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00028 domain.

Putative uncharacterized protein contains a PF00028 domain.

Putative uncharacterized protein contains a PF01049 domain.

Putative uncharacterized protein contains a PF08758 domain.

Putative uncharacterized protein contains a PF00028 domain.

Putative uncharacterized protein contains a PF00028 domain.

Putative uncharacterized protein contains a PF00028 domain.

Putative uncharacterized protein is proteolytically cut by meprin beta subunit (M12.004) cleavage..

Putative uncharacterized protein is proteolytically cut by meprin beta subunit (M12.004) cleavage..

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..

Putative uncharacterized protein is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..

Putative uncharacterized protein is proteolytically cut by meprin beta subunit (M12.004) cleavage..

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage..

Putative uncharacterized protein is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..

Putative uncharacterized protein is proteolytically cut by presenilin 1 (A22.001) cleavage. LLFL-RRRA.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. KAQP-VEAG.

Putative uncharacterized protein is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. LLIL-SDVN.

Putative uncharacterized protein is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. LILS-DVND.

Putative uncharacterized protein is proteolytically cut by calpain-1 (C02.001) cleavage..