Homo sapiens

MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVH
DFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKV
VLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSL
SSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTE
KFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEV
VLSRKVLLDGVQNLRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKT
PKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPL
SITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMD
RAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGA
SGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDK
GVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAEL
QCPQPAARRRRSVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEAC
KKVFLDCCNYITELRRQHARASHLGLARSNLDEDIIAEENIVSRSEFPESWLWNVEDLKE
PPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVV
RNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVI
VPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKE
DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTP
TVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTA
YVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKD
MALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMG
RLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQR
YYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLR
SEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDA
KNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSD
RNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDG
KLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDE
YIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSY
IIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by C3 convertase () cleavage. GLAR-SNLD.

is proteolytically cut by Cobra venom protease () cleavage. IIAE-ENIV.

is proteolytically cut by Cobra venom protease () cleavage. PVAQ-MTED.

is proteolytically cut by Cobra venom protease () cleavage. AKAK-DQLT.

is proteolytically cut by mannan-binding lectin-associated serine peptidase 2 (S01.229) cleavage..

is proteolytically cut by C3 convertase () cleavage. GLAR-SNLD.

is proteolytically cut by Cobra venom protease () cleavage. IIAE-ENIV.

is proteolytically cut by Cobra venom protease () cleavage. PVAQ-MTED.

is proteolytically cut by Cobra venom protease () cleavage. AKAK-DQLT.

is proteolytically cut by mannan-binding lectin-associated serine peptidase 2 (S01.229) cleavage..

is proteolytically cut by complement factor I (S01.199) cleavage. LPSR-SSKI.

is proteolytically cut by cathepsin G (S01.133) cleavage. GLAR-SNLD.

is proteolytically cut by cathepsin G (S01.133) cleavage. RSNL-DEDI.

is proteolytically cut by complement component 2 (S01.194) cleavage. GLAR-SNLD.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..

is proteolytically cut by mannan-binding lectin-associated serine peptidase 1 (S01.198) cleavage..

is proteolytically cut by C3 convertase () cleavage. GLAR-SNLD.

is proteolytically cut by Cobra venom protease () cleavage. IIAE-ENIV.

is proteolytically cut by Cobra venom protease () cleavage. PVAQ-MTED.

is proteolytically cut by Cobra venom protease () cleavage. AKAK-DQLT.

is proteolytically cut by mannan-binding lectin-associated serine peptidase 2 (S01.229) cleavage..

is proteolytically cut by complement factor I (S01.199) cleavage. LPSR-SSKI.

is proteolytically cut by cathepsin G (S01.133) cleavage. GLAR-SNLD.

is proteolytically cut by cathepsin G (S01.133) cleavage. RSNL-DEDI.

is proteolytically cut by complement component 2 (S01.194) cleavage. GLAR-SNLD.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..

is proteolytically cut by mannan-binding lectin-associated serine peptidase 1 (S01.198) cleavage..

is proteolytically cut by carboxypeptidase N (M14.004) cleavage. LGLA-R---.