Homo sapiens

MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLVLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISSCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by thrombin (S01.217) cleavage. LDPR-SFLL.

is proteolytically cut by platelet-aggregating venom peptidase (S01.180) cleavage. LDPR-SFLL.

is proteolytically cut by platelet-aggregating venom peptidase (S01.180) cleavage. FLLR-NPND.

is proteolytically cut by coagulation factor Xa (S01.216) cleavage..

is proteolytically cut by cathepsin G (S01.133) cleavage. LDPR-SFLL.

is proteolytically cut by cathepsin G (S01.133) cleavage. YEPF-WEDE.

is proteolytically cut by cathepsin G (S01.133) cleavage. LTEY-RLVS.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. YRLV-SINK.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. LVSI-NKSS.

is proteolytically cut by myeloblastin (S01.134) cleavage. YRLV-SINK.

is proteolytically cut by cathepsin G (S01.133) cleavage. LTEY-RLVS.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. YRLV-SINK.

is proteolytically cut by neutrophil elastase (S01.131) cleavage. LVSI-NKSS.

is proteolytically cut by cathepsin G (S01.133) cleavage. LDPR-SFLL.

is proteolytically cut by cathepsin G (S01.133) cleavage. YEPF-WEDE.

is proteolytically cut by myeloblastin (S01.134) cleavage. YRLV-SINK.

is proteolytically cut by thrombin (S01.217) cleavage. LDPR-SFLL.

is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. LDPR-SFLL.