Proteinase-activated receptor 1

UniProt : P25116, UniProt ID: PAR1_HUMAN,

Proteinase-activated receptor 1

Homo sapiens

MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Proteinase-activated receptor 1 contains a PF00001 domain.

Proteinase-activated receptor 1 is proteolytically cut by tryptase alpha (S01.143) cleavage. LDPR-SFLL.

Proteinase-activated receptor 1 is proteolytically cut by tryptase alpha (S01.143) cleavage. FLLR-NPND.

Proteinase-activated receptor 1 is proteolytically cut by tryptase alpha (S01.143) cleavage. PNDK-YEPF.

Proteinase-activated receptor 1 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. LDPR-SFLL.

Proteinase-activated receptor 1 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. PRSF-LLRN.

Proteinase-activated receptor 1 is proteolytically cut by kallikrein hK14 (S01.029) cleavage. FLLR-NPND.

Proteinase-activated receptor 1 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. LDPR-SFLL.

Proteinase-activated receptor 1 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. DPRS-FLLR.

Proteinase-activated receptor 1 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. PRSF-LLRN.

Proteinase-activated receptor 1 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. SFLL-RNPN.

Proteinase-activated receptor 1 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. FLLR-NPND.

Proteinase-activated receptor 1 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. LDPR-SFLL.

Proteinase-activated receptor 1 is proteolytically cut by kallikrein hK5 (S01.017) cleavage. PRSF-LLRN.