cDNA, FLJ95729, Homo sapiens ephrin-B3 (EFNB3), mRNA (Ephrin-B3, isoform CRA_a)

UniProt : B2RBW2, Q15768, UniProt ID: B2RBW2_HUMAN, EFNB3_HUMAN,

cDNA, FLJ95729, Homo sapiens ephrin-B3 (EFNB3), mRNA (Ephrin-B3, isoform CRA_a)

Homo sapiens

MGPPHSGPGGVRVGALLLLGVLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDL
LCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEY
SPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKP
VSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSMPAVAGAAGGLALLLL
GVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGELGIALRGG
GAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ95729, Homo sapiens ephrin-B3 (EFNB3), mRNA (Ephrin-B3, isoform CRA_a) contains a PF00812 domain.

cDNA, FLJ95729, Homo sapiens ephrin-B3 (EFNB3), mRNA (Ephrin-B3, isoform CRA_a) is proteolytically cut by Rhomboid-1 (S54.001) cleavage..

cDNA, FLJ95729, Homo sapiens ephrin-B3 (EFNB3), mRNA (Ephrin-B3, isoform CRA_a) is proteolytically cut by Rhomboid-1 (S54.001) cleavage..

cDNA, FLJ95729, Homo sapiens ephrin-B3 (EFNB3), mRNA (Ephrin-B3, isoform CRA_a) is proteolytically cut by rhomboid-like protein 2 (S54.002) cleavage..