Complement component 2 (Complement component 2, isoform CRA_b) (cDNA, FLJ92956, Homo sapiens complement component 2 (C2), mRNA)

UniProt : P06681, Q5JP69, UniProt ID: CO2_HUMAN, Q5JP69_HUMAN,

Complement component 2 (Complement component 2, isoform CRA_b) (cDNA, FLJ92956, Homo sapiens complement component 2 (C2), mRNA)

Homo sapiens

MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA
SRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDG
FILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSN
LVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKES
LGRKIQIQRSGHLNLYLLLDCSQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFAS
EPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGME
TMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRNDYLDIYAIGVGKLDVDW
RELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPW
HVTIKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVI
SPGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTC
RDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVT
DQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRS
KVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Complement component 2 (Complement component 2, isoform CRA_b) (cDNA, FLJ92956, Homo sapiens complement component 2 (C2), mRNA) contains a PF00084 domain.

Complement component 2 (Complement component 2, isoform CRA_b) (cDNA, FLJ92956, Homo sapiens complement component 2 (C2), mRNA) contains a PF00084 domain.

Complement component 2 (Complement component 2, isoform CRA_b) (cDNA, FLJ92956, Homo sapiens complement component 2 (C2), mRNA) contains a PF00089 domain.

Complement component 2 (Complement component 2, isoform CRA_b) (cDNA, FLJ92956, Homo sapiens complement component 2 (C2), mRNA) contains a PF00092 domain.

Complement component 2 (Complement component 2, isoform CRA_b) (cDNA, FLJ92956, Homo sapiens complement component 2 (C2), mRNA) is proteolytically cut by mannan-binding lectin-associated serine peptidase 2 (S01.229) cleavage. SLGR-KIQI.

Complement component 2 (Complement component 2, isoform CRA_b) (cDNA, FLJ92956, Homo sapiens complement component 2 (C2), mRNA) is proteolytically cut by mannan-binding lectin-associated serine peptidase 1 (S01.198) cleavage. SLGR-KIQI.

Complement component 2 (Complement component 2, isoform CRA_b) (cDNA, FLJ92956, Homo sapiens complement component 2 (C2), mRNA) is proteolytically cut by complement component activated C1s (S01.193) cleavage. SLGR-KIQI.